Home > Product > Antimicrobial Peptides > Beta-defensin13

Antimicrobial Peptides

Beta-defensin13

[Price Inquiry]
CAT#
AF3119
Sequence
TLYRRFLCKKMKGRCETACLSFEKKIGTCRADLTPLCCKEKKKH
Host Chemicals
Rattus norvegicus
Length
44
Activity
Antibacterial
SwissProt ID
Q32ZH8
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.