Home > Product > Antimicrobial Peptides > Beta-defensin134

Antimicrobial Peptides

Beta-defensin134

[Price Inquiry]
CAT#
AF2825
Sequence
EMHKKCYKNGICRLECYESEMLVAYCMFQLECCVKGNPAP
Host Chemicals
Pan troglodytes
Length
40
Activity
Antibacterial
SwissProt ID
Q30KJ5
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.