Home > Product > Antimicrobial Peptides > Beta-defensin14

Antimicrobial Peptides

warning All products are for research use only. Not for human use.

Beta-defensin14

[Price Inquiry]
CAT#
AF3136
Sequence
FIPKSLRRFFCRVRGGRCAILNCLGKEEQIGRCSNRGQKCCRKKK
Host Chemicals
Rattus norvegicus
Length
45
Activity
Antibacterial
SwissProt ID
Q32ZH7
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.