Home > Product > Antimicrobial Peptides > Beta-defensin3

Antimicrobial Peptides

Beta-defensin3

[Price Inquiry]
CAT#
AF2888
Sequence
KKVYNAVSCMTNGGICWLKCSGTFREIGSCGTRQLKCCKKK
Host Chemicals
Rattus norvegicus
Length
41
Activity
Antibacterial
SwissProt ID
Q32ZI4
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.