CAT# | AF2888 |
Sequence | KKVYNAVSCMTNGGICWLKCSGTFREIGSCGTRQLKCCKKK |
Activity | Antibacterial |
Host Chemicals | Rattus norvegicus | Length | 41 | SwissProt ID | Q32ZI4 |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
AF3343 | CAP-18, rabbit | Inquiry | ||
AF2783 | Cecropin-2 | Inquiry | ||
AF2541 | Halocin-S8 | Inquiry | ||
AF1963 | Human KS-30 | Inquiry | ||
AF450 | Temporin-ALd | Inquiry |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
10-101-20 | Goserelin Acetate | 1269.43 | C59H84N18O14 | Inquiry |
10-101-59 | Liraglutide | 3751.2 | C172H265N43O51 | Inquiry |
R1574 | Octreotide | 1019.24 | C₄₉H₆₆N₁₀O₁₀S₂ | Inquiry |
10-101-139 | Myrcludex B | Inquiry | ||
10-101-285 | Teduglutide | 3752.08 | C164H252N44O55S | Inquiry |
R1847 | Sermaglutide | 4114 | C187H291N45O59 | Inquiry |
R1961 | Carbetocin | 988.2 | C45H69N11O12S | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Linaclotide, sold under the brand name Linzess, is a synthetic tetradecapeptide and guanylate cyclase (GC-C) rec ...
Kassinin, a new peptide of amphibian origin, has been traced in the skin of the African frog Kassina senegalensi ...
PM102 is a novel synthetic peptide that effectively reverses the anticoagulant effect of heparin. It can be used ...
Iron chelating agent is a new type of iron-removing treatment based on the combination of directional and in viv ...
Background Signal peptides stimulate matrix protein production in general and collagen synthesis in specific. They may be acc ...