Home > Product > Antimicrobial Peptides > Beta-purothionin

Antimicrobial Peptides

Beta-purothionin

[Price Inquiry]
CAT#
AF3154
Sequence
KSCCKSTLGRNCYNLCRARGAQKLCANVCRCKLTSGLSCPKDFPK
Host Chemicals
Triticum aestivum
Length
45
Activity
Antibacterial
SwissProt ID
P01543
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.