Home > Product > Antimicrobial Peptides > BHT-A1

Antimicrobial Peptides

CAT#
AF2041
Sequence
GTTVVNSTFSIVLGNKGYICTVTVECMRNCQ
Host Chemicals
Streptococcus rattus BHT
Length
31
Activity
Gram+,
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.