Home > Product > Antimicrobial Peptides > BHT-B

Antimicrobial Peptides

warning All products are for research use only. Not for human use.
CAT#
AF3110
Sequence
MWGRILAFVAKYGTKAVQWAWKNKWFLLSLGEAVFDYIRSIWGG
Host Chemicals
Streptococcus rattus BHT
Length
44
Activity
Gram+,
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.