Home > Product > Antimicrobial Peptides > Big defensin 3

Antimicrobial Peptides

Big defensin 3

[Price Inquiry]
CAT#
AF2977
Sequence
AQILLPIASYAGLTVTAPVFVALVAAYGIYAVTRYAIRKRRIV
Host Chemicals
Crassostrea gigas
Length
43
Activity
Antimicrobial
SwissProt ID
F6M2J7
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.