Home > Product > Catalog Peptides > Others > Big Endothelin-1 (1-31) (human, bovine)

Others

Big Endothelin-1 (1-31) (human, bovine)

Price Inquiry
CAT#
E09020
Sequence
CSCSSLMDKECVYFCHLDIIWVNTPEHVVPY
M.W/Mr.
3628.21
Molecular Formula
C162H236N38O47S5
Length
31

Online Inquiry

First Name:
Last Name:
Phone:
Email: *
Service & Products of Interest: *
Services Required and Project Description:
Verification code: *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.