Home > Product > Catalog Peptides > Others > Big Endothelin-1 (human)

Others

warning All products are for research use only. Not for human use.

Big Endothelin-1 (human)

[Price Inquiry]
CAT#
E09021
Sequence
CSCSSLMDKECVYFCHLDIIWVNTPEHVVPYGLGSPRS
M.W/Mr.
4282.94
Molecular Formula
C189H282N48O56S5
Length
38
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.