Home > Product > Antimicrobial Peptides > BIN1b

Antimicrobial Peptides

warning All products are for research use only. Not for human use.
CAT#
AF3148
Sequence
GIRNTVCFMQRGHCRLFMCRSGERKGDICSDPWNRCCVSSSIKNR
Host Chemicals
Rattus norvegicus
Length
45
Activity
Antibacterial
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.