Home > Product > Antimicrobial Peptides > Bn-AFP1

Antimicrobial Peptides

warning All products are for research use only. Not for human use.
CAT#
AF3269
Sequence
KLCERSSGTWSGVCGNNNACKNQCIRLEGAQHGSCNYVFPAHKCICYFPC
Host Chemicals
Brassica napus
Length
50
Activity
Fungi,
SwissProt ID
SwissProt ID: Q39313
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.