Home > Product > Catalog Peptides > Others > BNP-45 (51-95), rat, 5K Cardiac Natriuretic Peptide

Others

BNP-45 (51-95), rat, 5K Cardiac Natriuretic Peptide

[Price Inquiry]
CAT#
B10008
Sequence
SQDSAFRIQERLRNSKMAHSSSCFGQKIDRIGAVSRLGCDGL
M.W/Mr.
5040.8
Modifications
disulfide
Length
42
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.