Home > Product > Catalog Peptides > Others > Botulinum Neurotoxin (BoNT) B Substrate Modification,amide, FITC - labeled

Others

warning All products are for research use only. Not for human use.

Botulinum Neurotoxin (BoNT) B Substrate Modification,amide, FITC - labeled

[Price Inquiry]
CAT#
T09019
Sequence
FITCLCLSELDDRADALQAGASQFESSAAKLKRKYWWKNLK-NH2
M.W/Mr.
4516
Length
41
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.