Home > Product > Antimicrobial Peptides > Bovine Beta-defensin 10

Antimicrobial Peptides

Bovine Beta-defensin 10

[Price Inquiry]
CAT#
AF2853
Sequence
QGVRSYLSCWGNRGICLLNRCPGRMRQIGTCLAPRVKCCR
Host Chemicals
Bos taurus
Length
40
Activity
Antibacterial
SwissProt ID
P46168
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.