Home > Product > Antimicrobial Peptides > Bovine Beta-defensin 3

Antimicrobial Peptides

Bovine Beta-defensin 3

[Price Inquiry]
CAT#
AF2953
Sequence
QGVRNHVTCRINRGFCVPIRCPGRTRQIGTCFGPRIKCCRSW
Host Chemicals
Bos taurus
Length
42
Activity
Antibacterial
SwissProt ID
P46161
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.