Home > Product > Antimicrobial Peptides > Br-AFP1

Antimicrobial Peptides

CAT#
AF3268
Sequence
KLCERSSGTWSGVCGNNNACKNQCINLEGARHGSCNYVFPYHRCICYFPC
Host Chemicals
Brassica rapa subsp. chinensis
Length
50
Activity
Fungi,
SwissProt ID
Reference ID: ADA70735
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.