Brain Natriuretic Peptide, Human
Brain Natriuretic Peptide, Human
Brain natriuretic peptide, uretic peptide or Ventricular Natriuretic Peptide (still BNP), is a 32-amino acid polypeptide secreted by the ventricles of the heart in response to excessive stretching of heart muscle cells (cardiomyocytes). BNP is named as such because it was originally identified in extracts of porcine brain, although in humans it is produced mainly in the cardiac ventricles.
Online Inquiry
| CAT# | 10-101-25 |
| CAS | 124584-08-3 (net) |
| Synonyms/Alias | Natriuretic Peptide, Brain; BNP-32; Natrecor; BNP; B-Type Natriuretic Peptide; BNP32; BNP 32; Nesiritide; Type-B Natriuretic Peptide |
| M.F/Formula | C143H244N50O42S4 |
| M.W/Mr. | 3464.09 |
| Sequence | SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH(Modifications: Disulfide bridge between 10 - 26) |
| Labeling Target | Atrial natriuretic peptide receptor |
| Application | Brain natriuretic peptide (BNP) decreases the systemic vascular resistance and central venous pressure as well as increases the natriuresis. Thus, the net effect of BNP and atrial natriuretic peptide (ANP) is a decrease in blood volume, which lowers systemic blood pressure and afterload, yielding an increase in cardiac output, partly due to a higher ejection fraction. |
| Areas of Interest | Cardiovascular Disease |
| Functions | Protein kinase activity |
| Source# | Synthetic |
Long-term Storage Conditions | −20°C |
Organism | Human |
BoilingPoint | N/A |
Melting Point | N/A |
Write a review
Ask a question
My Review for Brain Natriuretic Peptide, Human
Required fields are marked with *
×
Ask a Question for Brain Natriuretic Peptide, Human
Required fields are marked with *
×
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.
