Home > Product > Antimicrobial Peptides > Brevinin-2GHa

Antimicrobial Peptides

Brevinin-2GHa

[Price Inquiry]
CAT#
AF2348
Sequence
GFSSLFKAGAKYLLKSVGKAGAQQLACKAANNCA
Host Chemicals
Rana guentheri
Length
34
Activity
Antibacterial
SwissProt ID
P84860
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.