Home > Product > Antimicrobial Peptides > Brevinin-2LF2 antimicrobial peptide precursor

Antimicrobial Peptides

Brevinin-2LF2 antimicrobial peptide precursor

[Price Inquiry]
CAT#
AF2124
Sequence
IMSTLKQFGISAIKGAAQNVLGVLSCKIAKTC
Host Chemicals
Amolops lifanensis
Length
32
Activity
Antimicrobial
SwissProt ID
E1B2T7
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.