Home > Product > Antimicrobial Peptides > Brevinin-2LTa

Antimicrobial Peptides

Brevinin-2LTa

[Price Inquiry]
CAT#
AF1890
Sequence
GAFGDLLKGVAKEAGMKLLNMAQCKLSGKC
Host Chemicals
the broad-folded frog, Hylarana latouchii, China, Asia
Length
30
Activity
Gram+ & Gram-,
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.