Home > Product > Antimicrobial Peptides > Brevinin-2PRa

Antimicrobial Peptides

Brevinin-2PRa

[Price Inquiry]
CAT#
AF2626
Sequence
GLMSLFKGVLKTAGKHIFKNVGGSLLDQAKCKITGEC
Host Chemicals
Rana pirica
Length
37
Activity
Antibacterial
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.