Home > Product > Antimicrobial Peptides > Brevinin-2PRc

Antimicrobial Peptides

Brevinin-2PRc

[Price Inquiry]
CAT#
AF2629
Sequence
GLMSVTKGVLKTAGKHIFKNVGGSLLDQAKCKISGQC
Host Chemicals
Rana pirica
Length
37
Activity
Antibacterial, Antifungal
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.