Home > Product > Antimicrobial Peptides > Brevinin-2PRd

Antimicrobial Peptides

warning All products are for research use only. Not for human use.

Brevinin-2PRd

[Price Inquiry]
CAT#
AF2628
Sequence
GLMSVLKGVLKTAGKHIFKNVGGSLLDQAKCKITGQC
Host Chemicals
Rana pirica
Length
37
Activity
Antibacterial, Antifungal
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.