Home > Product > Antimicrobial Peptides > Brevinin -2 Grc , esculentin-2-OG10

Antimicrobial Peptides

warning All products are for research use only. Not for human use.

Brevinin -2 Grc , esculentin-2-OG10

[Price Inquiry]
CAT#
AF2619
Sequence
GLFTLIKGAAKLIGKTVAKEAGKTGLELMACKITNQC
Host Chemicals
Rana grahami
Length
37
Activity
Antibacterial, Antifungal
SwissProt ID
A6MAW5
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.