CAT# | AF2083 |
Sequence | FLDTLKNMAINAAKDAGVSVLNPLSCKLFKTC |
Activity | Antimicrobial |
Host Chemicals | Odorrana andersonii (golden crossband frog) | Length | 32 | SwissProt ID | E3SYL0 |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
AF3313 | Pg-AMP1 | Inquiry | ||
AF2226 | Brevinin-2E-OG4 antimicrobial peptide | Inquiry | ||
AF1497 | Distinctin | Inquiry | ||
AF2238 | Brevinin-2-RA22 antimicrobial peptide | Inquiry | ||
AF1092 | Hyfl P | Inquiry |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
10-101-20 | Goserelin Acetate | 1269.43 | C59H84N18O14 | Inquiry |
10-101-59 | Liraglutide | 3751.2 | C172H265N43O51 | Inquiry |
R1574 | Octreotide | 1019.24 | C₄₉H₆₆N₁₀O₁₀S₂ | Inquiry |
10-101-139 | Myrcludex B | Inquiry | ||
10-101-285 | Teduglutide | 3752.08 | C164H252N44O55S | Inquiry |
R1847 | Sermaglutide | 4114 | C187H291N45O59 | Inquiry |
R1961 | Carbetocin | 988.2 | C45H69N11O12S | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×1. Low bone turnover and low BMD in Down syndrome: effect of intermittent PTH treatment
2. An Open-label, Single-center, Safety and Efficacy Study of Eyelash Polygrowth Factor Serum
4. Store-operated Ca2+ entry sustains the fertilization Ca2+ signal in pig eggs
5. Cell-based adhesion assays for isolation of snake venom’s integrin antagonists
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
NG-monomethyl-L-arginine (L-NMMA) acetate, a structural analogue of L-arginine, also named tilarginine acetate a ...
Myristoyl hexapeptide-4, a stabilized peptide, is a synthetic peptide containing lysine, threonine and serine re ...
Histrelin acetate, sold under many brand name like Vantas, Supprelin LA and others, is a nonapeptide analog of g ...
ClC-2 chloride channels are voltage-gated ion channels that are expressed in neuronal and epithelial cells wher ...
Fertirelin acetate, classified into peptide hormone, is a gonadotropin-releasing hormone (GnRH) antagonist or ...