Home > Product > Antimicrobial Peptides > Brevinin-2-RA19 peptide precursor

Antimicrobial Peptides

Brevinin-2-RA19 peptide precursor

[Price Inquiry]
CAT#
AF2083
Sequence
FLDTLKNMAINAAKDAGVSVLNPLSCKLFKTC
Host Chemicals
Odorrana andersonii (golden crossband frog)
Length
32
Activity
Antimicrobial
SwissProt ID
E3SYL0
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.