Home > Product > Antimicrobial Peptides > Brochocin C

Antimicrobial Peptides

Brochocin C

[Price Inquiry]
CAT#
AF3330
Sequence
YSSKDCLKDIGKGIGAGTVAGAAGGGLAAGLGAIPGAFVGAHFGVIGGSAACIGGLLGN
Host Chemicals
Brochothrix campestris ATCC 43754
Length
59
Activity
Gram+,
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.