Home > Product > Antimicrobial Peptides > Buforin-1

Antimicrobial Peptides

CAT#
AF2758
Sequence
AGRGKQGGKVRAKAKTRSSRAGLQFPVGRVHRLLRKGNY
Host Chemicals
Bufo gargarizans
Length
39
Activity
Antibacterial, Antifungal
SwissProt ID
P55897
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.