Home > Product > Antimicrobial Peptides > Buthinin

Antimicrobial Peptides

warning All products are for research use only. Not for human use.
CAT#
AF2388
Sequence
SIVPIRCRSNRDCRRFCGFRGGRCTYARQCLCGY
Host Chemicals
Androctonus australis
Length
34
Activity
Antibacterial
SwissProt ID
P56685
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.