CAT# | A32002 |
Sequence | SAPEDELAFEDYEDQDYFHPRALSIPSEIEHDNEKESDAFSILSRG |
Length | 46 |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
X19756 | UP_P82158 | Inquiry | ||
X20899 | UP_Q9PS49 | Inquiry | ||
I0805 | Trypsin-Modulating Oostatic Factor (Neobelliera bullata) | Inquiry | ||
X00629 | PH1BS011_17 | Inquiry | ||
X12477 | PM_4019503 | Inquiry |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
10-101-20 | Goserelin Acetate | 1269.43 | C59H84N18O14 | Inquiry |
10-101-59 | Liraglutide | 3751.2 | C172H265N43O51 | Inquiry |
R1574 | Octreotide | 1019.24 | C₄₉H₆₆N₁₀O₁₀S₂ | Inquiry |
10-101-139 | Myrcludex B | Inquiry | ||
10-101-285 | Teduglutide | 3752.08 | C164H252N44O55S | Inquiry |
R1847 | Sermaglutide | 4114 | C187H291N45O59 | Inquiry |
R1961 | Carbetocin | 988.2 | C45H69N11O12S | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Sinapultide (also known as KL4 peptide) is a synthetic protein used to mimic human SP-B. Respiratory distress ...
Insulin was discovered by Banting and Best in 1921. Soon afterwards manufacturing processes were developed to extract the ins ...
The β-amyloid precursor protein (APP) is connected to Alzheimer's disease by both biochemistry and genetics. As ...
Factors of natural aging Natural aging of the skin results in decreased production and increased degradation of extracellula ...
The voltage-gated Kv1.3 channel in effector memory T cells serves as a new therapeutic target for multiple scler ...