Home > Product > Catalog Peptides > Others > C peptide

Others

CAT#
A32002
Sequence
SAPEDELAFEDYEDQDYFHPRALSIPSEIEHDNEKESDAFSILSRG
Length
46
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.