Home > Product > Antimicrobial Peptides > Caenacin-1

Antimicrobial Peptides

warning All products are for research use only. Not for human use.

Caenacin-1

[Price Inquiry]
CAT#
AF3117
Sequence
QWGYNSYGYGNYGGYGGYPMYGGYGMNGGYGGGGLLGMFLGKKK
Host Chemicals
Caenorhabditis elegans
Length
44
Activity
Antifungal
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.