Home > Product > Catalog Peptides > Others > Calcitonin, eel

Others

Calcitonin, eel

[Price Inquiry]
CAT#
C06008
Sequence
CSNLSTCVLGKLSQELHKLQTYPRTDVGAGTP-NH2
M.W/Mr.
3414.9
Modifications
disulfide
Length
32
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.