Home > Product > Catalog Peptides > Others > Calcitonin (human)

Others

Calcitonin (human)

[Price Inquiry]
CAT#
C06009
Sequence
CGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAP-NH2
M.W/Mr.
3417.90
Molecular Formula
C151H226N40O45S3
Length
32
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.