Home > Product > Catalog Peptides > Others > Calcitonin, porcine

Others

Calcitonin, porcine

[Price Inquiry]
CAT#
C06012
Sequence
CSNLSTCVLSAYWRNLNNFHRFSGMGFGPETP-NH2
M.W/Mr.
3604.1
Modifications
disulfide
Length
32
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.