Home > Product > Antimicrobial Peptides > Callinectin

Antimicrobial Peptides

Callinectin

[Price Inquiry]
CAT#
AF2171
Sequence
WNSNRRFRVGRPPVVGRPGCVCFRAPCPCSNY
Host Chemicals
Callinectes sapidus
Length
32
Activity
Antibacterial
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.