Keywords Search Google Search Search

Callinectin

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	AF2171
Sequence	WNSNRRFRVGRPPVVGRPGCVCFRAPCPCSNY
Activity	Antibacterial

CAT#	Product Name	Inquiry
AF1574	NGU Guentherin	Inquiry
AF2353	Corticostatin 1	Inquiry
AF511	Temporin-SHd	Inquiry
AF3240	Penaeidin-4C	Inquiry
AF1532	Latarcin-2b	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

Abaloparatide Helps Osteoporotic Fractures Treatment

What is abaloparatide? Abaloparatide (formerly known as BA058) is an investigational analog of human PTHrP (1-34) being devel ...

UFP-101-A Peptide Antagonist Selective for the Nociceptin/Orphanin FQ Receptor

Nociceptin/orphanin FQ (N/OFQ) modulates various biological functions, including nociception, via selective stim ...

Function of palmitoyl tripeptide-38 in skin

Palmitoyl Tripeptide-38, named MATRIXYL synthe'6 and Volulip, a cosmetic peptide or double-oxidized lipopeptide, ...

Mechanism of Acetyl Tetrapeptide-22

The 70-kDa heat shock protein (HSP70) contains three domains: the ATPase N-domain, which hydrolyses ATP, the sub ...

Compstatin: a pharmaceutical inhibitor of complement

Compstatin is a 13-residue cyclic peptide (Ile1-Cys2-Val3-Val4-Gln5-Asp6-Trp7-Gly8-His9-His10-Arg11-Cys12-Thr13- ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address:

Host Chemicals	Callinectes sapidus
Length	32