Home > Product > Antimicrobial Peptides > Canine beta-defensin

Antimicrobial Peptides

Canine beta-defensin

[Price Inquiry]
CAT#
AF2370
Sequence
KCWNLRGSCREKCIKNEKLYIFCTSGKLCCLKPK
Host Chemicals
Canis lupus familiaris
Length
34
Activity
Antibacterial, Antifungal
SwissProt ID
Q863C8
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.