Home > Product > Antimicrobial Peptides > Carnobacteriocin B2

Antimicrobial Peptides

Carnobacteriocin B2

[Price Inquiry]
CAT#
AF3250
Sequence
VNYGNGVSCSKTKCSVNWGQAFQERYTAGINSFVSGVASGAGSIGRRP
Host Chemicals
Carnobacterium piscicola
Length
48
Activity
Gram+ & Gram-,
SwissProt ID
PDB ID: 1CW5
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.