Home > Product > Antimicrobial Peptides > Carnocyclin A

Antimicrobial Peptides

Carnocyclin A

Price Inquiry
CAT#
AF3336
Sequence
LVAYGIAQGTAEKVVSLINAGLTVGSIISILGGVTVGLSGVFTAVKAAIAKQGIKKAIQL
Host Chemicals
Carnobacterium maltaromaticum UAL307
Length
60
Activity
Gram+,
SwissProt ID
PDB ID: 2KJF

Online Inquiry

First Name:
Last Name:
Phone:
Email: *
Service & Products of Interest: *
Services Required and Project Description:
Verification code: *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.