Home > Product > Antimicrobial Peptides > Carnocyclin A

Antimicrobial Peptides

Carnocyclin A

[Price Inquiry]
CAT#
AF3336
Sequence
LVAYGIAQGTAEKVVSLINAGLTVGSIISILGGVTVGLSGVFTAVKAAIAKQGIKKAIQL
Host Chemicals
Carnobacterium maltaromaticum UAL307
Length
60
Activity
Gram+,
SwissProt ID
PDB ID: 2KJF
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.