Home > Product > Catalog Peptides > Others > CART (55-102) (human)

Others

CART (55-102) (human)

[Price Inquiry]
CAT#
C24003
Sequence
VPIYEKKYGQVPMCDAGEQCAVRKGARIGKLCDCPRGTSCNSFLLKCL
M.W/Mr.
5245.23
Molecular Formula
C225H365N65O65S7
Length
48
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.