Home > Product > Catalog Peptides > Others > CART (55-102) (human)

Others

CART (55-102) (human)

Price Inquiry
CAT#
C24003
Sequence
VPIYEKKYGQVPMCDAGEQCAVRKGARIGKLCDCPRGTSCNSFLLKCL
M.W/Mr.
5245.23
Molecular Formula
C225H365N65O65S7
Length
48

Online Inquiry

First Name:
Last Name:
Phone:
Email: *
Service & Products of Interest: *
Services Required and Project Description:
Verification code: *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.