Home > Product > Catalog Peptides > Others > CART (61-102) (human, rat)

Others

CART (61-102) (human, rat)

[Price Inquiry]
CAT#
C24001
Sequence
KYGQVPMCDAGEQCAVRKGARIGKLCDCPRGTSCNSFLLKCL
M.W/Mr.
4515.36
Molecular Formula
C189H310N58O56S7
Length
42
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.