Home > Product > Catalog Peptides > Others > CART (55-102) (rat)

Others

warning All products are for research use only. Not for human use.

CART (55-102) (rat)

[Price Inquiry]
CAT#
C24004
Sequence
IPIYEKKYGQVPMCDAGEQCAVRKGARIGKLCDCPRGTSCNSFLLKCL
M.W/Mr.
5259.26
Molecular Formula
C226H367N65O65S7
Length
48
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.