Home > Product > Antimicrobial Peptides > Casocidin-1

Antimicrobial Peptides

Casocidin-1

[Price Inquiry]
CAT#
AF2791
Sequence
KTKLTEEEKNRLNFLKKISQRYQKFALPQYLKTVYQHQK
Host Chemicals
Bos taurus
Length
39
Activity
Antibacterial
SwissProt ID
P02663
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.