CAT# | AF2948 |
Sequence | LRKKFRKTRKRIQKLGRKIGKTGRKVWKAWREYGQIPYPCRI |
Activity | Antibacterial |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Studies on the binding affinities of darifenacin hydrobromide and human muscarinic receptor subtypes show strong ...
Introduce of lipopeptide Lipopeptide (peptidolipid), also known as acylpeptide, is composed of hydrophilic peptide bond and l ...
Leuprolide acetate, an acetate salt with similar structure to luteinizing hormone-releasing hormone (LHRH) secre ...
PMX-53, a chemically synthesized peptide material, is a potent C5a antagonist in human neutrophils and macrophag ...
The endocytosis of AMPA receptors (AMPARs) requires the GTPase activity of dynamin. Since it is now established ...