Home > Product > Antimicrobial Peptides > Cathelicidin antimicrobial peptide precursor

Antimicrobial Peptides

Cathelicidin antimicrobial peptide precursor

[Price Inquiry]
CAT#
AF2948
Sequence
LRKKFRKTRKRIQKLGRKIGKTGRKVWKAWREYGQIPYPCRI
Host Chemicals
Cavia porcellus
Length
42
Activity
Antibacterial
SwissProt ID
Q91X12
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.