Home > Product > Antimicrobial Peptides > Cathelicidin-4

Antimicrobial Peptides

warning All products are for research use only. Not for human use.

Cathelicidin-4

[Price Inquiry]
CAT#
AF2659
Sequence
NEDLGTRKPVSFTVKETVCPRTTHQPAEQCGFKERGR
Host Chemicals
Bubalus bubalis
Length
37
Activity
Antimicrobial
SwissProt ID
C7FEV5
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.