Home > Product > Antimicrobial Peptides > CBD-1

Antimicrobial Peptides

CAT#
AF2944
Sequence
KCWNLRGSCREKCIKNEKLYIFCTSGKLCCLKPKFQPNMLQR
Host Chemicals
Canis lupus
Length
42
Activity
Antibacterial, Antifungal
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.