Home > Product > Catalog Peptides > Others > CCB peptide

Others

warning All products are for research use only. Not for human use.

CCB peptide

[Price Inquiry]
CAT#
C45001
Sequence
SAEFPDFYDSEEPVSTHQEAENEKDRADQTVLTEDEKKELENLAAMDLELQKIAEKFSQR
Modifications
Phosphoserine
Length
60
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.