Home > Product > Antimicrobial Peptides > CEC4_BOMMO Cecropin

Antimicrobial Peptides

CEC4_BOMMO Cecropin

[Price Inquiry]
CAT#
AF2462
Sequence
RWKIFKKIEKVGQNIRDGIVKAGPAVAVVGQAATI
Host Chemicals
Bombyx mori
Length
35
Activity
Antibacterial
SwissProt ID
P14666
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.