Home > Product > Antimicrobial Peptides > CECD_BOMMO Cecropin-D precursor

Antimicrobial Peptides

CECD_BOMMO Cecropin-D precursor

[Price Inquiry]
CAT#
AF2501
Sequence
GNFFKDLEKMGQRVRDAVISAAPAVDTLAKAKALGQ
Host Chemicals
Bombyx mori
Length
36
Activity
Antibacterial
SwissProt ID
O76146
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2017 Creative Peptides. All rights reserved.