Keywords Search Google Search Search

CECD_BOMMO Cecropin-D precursor

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	AF2501
Sequence	GNFFKDLEKMGQRVRDAVISAAPAVDTLAKAKALGQ
Activity	Antibacterial

CAT#	Product Name	Inquiry
AF2276	Latarcin 6a	Inquiry
AF1180	Lividin-1a protein	Inquiry
AF2044	Circulin-B	Inquiry
AF2793	Moricin-like peptide A	Inquiry
AF2605	Esculentin-2A	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

Function of myristoyl pentapeptide-8 in skin and eyelash

Myristoyl pentapeptide-8, a cosmetic peptide, is a synthetic peptide containing arginine, aspartic acid, glycine ...

Function of NFAT inhibitor

NFAT, the nuclear factor of activated T cells, is a family of transcription factors that play an important role ...

The Function of Cyclosporin A as an Immunosuppressant

Cyclosporin A (CsA) is a cyclic polypeptide consisting of 11 amino acids, which contains a new amino acid contai ...

Very Late Antigen-4 blocker-BIO 1211

BIO 1211, is a non-covalent, small-molecule, cyclohexanecarboxylic acid base compound, tight-binding inhibitor ( ...

The Function of CRF (ovine) Trifluoroacetate in Parkinson's Disease

Corticotropin-releasing factor (CRF) is a 41 amino acid peptide that is an important hormone in the hypothalamic ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address:

Host Chemicals	Bombyx mori
Length	36
SwissProt ID	O76146