Home > Product > Antimicrobial Peptides > CECE_BOMMO Antibacterial peptide enbocin precursor

Antimicrobial Peptides

warning All products are for research use only. Not for human use.

CECE_BOMMO Antibacterial peptide enbocin precursor

[Price Inquiry]
CAT#
AF2663
Sequence
PWNIFKEIERAVARTRDAVISAGPAVRTVAAATSVAS
Host Chemicals
Bombyx mori
Length
37
Activity
Antibacterial
SwissProt ID
P48821
Home | Site Map | Contact Us | Resources
Copyright © 2008 - 2016 Creative Peptides. All rights reserved.