Home > Product > Antimicrobial Peptides > Cecropin-A

Antimicrobial Peptides

Cecropin-A

[Price Inquiry]
CAT#
AF2539
Sequence
RWKVFKKIEKVGRNVRDGIIKAGPAIGVLGQAKALG
Host Chemicals
Spodoptera litura
Length
36
Activity
Antibacterial
SwissProt ID
Q9XZG9
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.