Cecropin A is a linear 37-residue antimicrobial polypeptide, with anticancer and anti-inflammatory activity.
CAT# | R1273 |
CAS | 80451-04-3 |
M.F/Formula | C₁₈₄H₃₁₃N₅₃O₄₆ |
M.W/Mr. | 4003.78 |
Sequence | One Letter Code: KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK-NH2 three Letter Code: Lys-Trp-Lys-Leu-Phe-Lys-Lys-Ile-Glu-Lys-Val-Gly-Gln-Asn-Ile-Arg-Asp-Gly-Ile-Ile-Lys-Ala-Gly-Pro-Ala-Val-Ala-Val-Val-Gly-Gln-Ala-Thr-Gln-Ile-Ala-Lys-NH2 |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Corticotropin (ACTH or adrenocorticotropic hormone) is a linear coupling of 39 amino acid residues and an import ...
MEN 11270 (H-DArg-Arg-Pro-Hyp-Gly-Thi-c(Dab-Dtic-Oic-Arg)c(7γ-10α)) is a novel selective constrained peptide ant ...
Gonadorelin acetate, a synthetic decapeptide with sequence Glp-His-Trp-Ser-Tyr-Gly-Leu-Arg-Pro-Gly-NH2, is a gon ...
NFAT, the nuclear factor of activated T cells, is a family of transcription factors that play an important role ...
NG-monomethyl-L-arginine (L-NMMA) acetate, a structural analogue of L-arginine, also named tilarginine acetate a ...